TA339581 CRISP11 antibody

Rabbit Polyclonal Anti-CRISPLD2 Antibody

See related secondary antibodies

Search for all "CRISP11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat CRISP11

TA339581

More Views

  • TA339581
  • TA339581

Product Description for CRISP11

Rabbit anti Human, Mouse, Rat CRISP11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CRISP11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CRISP-11, CRISPLD2, Cysteine-rich secretory protein 11, Cysteine-rich secretory protein LCCL domain-containing 2, LCCL domain-containing cysteine-rich secretory protein 2, LCRISP2
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0B8
Immunogen:
The immunogen for anti-CRISPLD2 antibody: synthetic peptide directed towards the N terminal of human CRISPLD2. Synthetic peptide located within the following region: MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA.
GeneID:
83716
Application WB
Background CRISPLD2 is a novel NSCLP candidate gene.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CRISP11 (2 products)

Catalog No. Species Pres. Purity   Source  

CRISP11

CRISP11 Human Purified
  Abnova Taiwan Corp.

CRISP11

CRISP11 Human Purified
  Abnova Taiwan Corp.

Positive controls for CRISP11 (2 products)

Catalog No. Species Pres. Purity   Source  

CRISPLD2 293T Cell Transient Overexpression Lysate(Denatured)

CRISPLD2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CRISPLD2 overexpression lysate

CRISPLD2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn