TA339586 PCDHA6 antibody

Rabbit Polyclonal Anti-PCDHA6 Antibody

See related secondary antibodies

Search for all "PCDHA6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PCDHA6

Product Description for PCDHA6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PCDHA6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PCDHA6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CNRS2, PCDH-alpha-6, Protocadherin alpha-6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UN73-3
Immunogen:
The immunogen for anti-PCDHA6 antibody: synthetic peptide directed towards the C terminal of human PCDHA6. Synthetic peptide located within the following region: LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY.
GeneID:
56142
Application WB
Background PCDHA6 contains 6 cadherin domains. It is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintence of specific neurol connections in the brain.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-termil exons, or variable exons, are followed by downstream C-termil exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-termil exons each encode six cadherin ectodomains while the C-termil exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Altertive splicing has been observed and additiol variants have been suggested but their full-length ture has yet to be determined.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PCDHA6 (1 products)

Catalog No. Species Pres. Purity   Source  

PCDHA6

PCDHA6 Human
  Abnova Taiwan Corp.
  • LinkedIn