TA339588 FTHL17 antibody

Rabbit Polyclonal Anti-FTHL17 Antibody

See related secondary antibodies

Search for all "FTHL17"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FTHL17

Product Description for FTHL17

Rabbit anti Human FTHL17.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FTHL17

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CT38, Cancer/testis antigen 38, Ferritin heavy polypeptide-like 17
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BXU8
Immunogen:
The immunogen for anti-FTHL17 antibody: synthetic peptide directed towards the N terminal of human FTHL17. Synthetic peptide located within the following region: MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIR.
GeneID:
53940
Application WB
Background This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FTHL17 (1 products)

Catalog No. Species Pres. Purity   Source  

FTHL17

FTHL17 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for FTHL17 (1 products)

Catalog No. Species Pres. Purity   Source  

FTHL17 overexpression lysate

FTHL17 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn