TA339592 Tetraspanin-10 / TSPAN10 antibody

Rabbit Polyclonal Anti-TSPAN10 Antibody

See related secondary antibodies

Search for all "Tetraspanin-10 / TSPAN10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Tetraspanin-10 / TSPAN10

Product Description for Tetraspanin-10 / TSPAN10

Rabbit anti Human Tetraspanin-10 / TSPAN10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tetraspanin-10 / TSPAN10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms OCSP, Oculospanin
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H1Z9
Immunogen:
The immunogen for anti-TSPAN10 antibody: synthetic peptide directed towards the N terminal of human TSPAN10. Synthetic peptide located within the following region: SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG.
GeneID:
83882
Application WB
Background TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein. The exact function of TSPAN10 remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Tetraspanin-10 / TSPAN10 (1 products)

Catalog No. Species Pres. Purity   Source  

Tetraspanin-10 / TSPAN10

Tetraspanin-10 / TSPAN10 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn