TA339593 SPATA9 antibody

Rabbit Polyclonal Anti-SPATA9 Antibody

See related secondary antibodies

Search for all "SPATA9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SPATA9

Product Description for SPATA9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SPATA9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPATA9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NYD-SP16, Spermatogenesis-associated protein 9
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BWV2
Immunogen:
The immunogen for anti-SPATA9 antibody: synthetic peptide directed towards the N terminal of human SPATA9. Synthetic peptide located within the following region: PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK.
GeneID:
83890
Application WB
Background SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SPATA9 (4 products)

Catalog No. Species Pres. Purity   Source  

SPATA9

SPATA9 Human Purified
  Abnova Taiwan Corp.

SPATA9

SPATA9 Human Purified
  Abnova Taiwan Corp.

SPATA9

SPATA9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SPATA9

SPATA9 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SPATA9 (3 products)

Catalog No. Species Pres. Purity   Source  

SPATA9 293T Cell Transient Overexpression Lysate(Denatured)

SPATA9 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SPATA9 Lysate

Western Blot: SPATA9 Lysate [NBL1-16385] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SPATA9
  Novus Biologicals Inc.

SPATA9 overexpression lysate

SPATA9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn