TA339603 MLSTD2 antibody

Rabbit Polyclonal Anti-FAR1 Antibody

See related secondary antibodies

Search for all "MLSTD2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MLSTD2

Product Description for MLSTD2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MLSTD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MLSTD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FAR1, Fatty acyl-CoA reductase 1, UNQ2423/PRO4981
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVX9
Immunogen:
The immunogen for anti-MLSTD2 antibody: synthetic peptide directed towards the N terminal of human MLSTD2. Synthetic peptide located within the following region: LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII.
GeneID:
84188
Application WB
Background FAR1 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn