TA339633 DIRC2 antibody

Rabbit Polyclonal Anti-DIRC2 Antibody

See related secondary antibodies

Search for all "DIRC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Mouse, Rabbit, Rat DIRC2

Product Description for DIRC2

Rabbit anti Equine, Guinea Pig, Human, Mouse, Rabbit, Rat DIRC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DIRC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Disrupted in renal cancer protein 2, Disrupted in renal carcinoma protein 2
Presentation Purified
Reactivity Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96SL1
Immunogen:
The immunogen for anti-DIRC2 antibody: synthetic peptide directed towards the middle region of human DIRC2. Synthetic peptide located within the following region: AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ.
GeneID:
84925
Application WB
Background DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and rel cell carcinomas. Altertively spliced transcript variants have been described, but their biological validity has not yet been determined.This gene encodes a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of this gene by translocation has been associated with haplo-insufficiency and rel cell carcinomas. Altertively spliced transcript variants have been described, but their biological validity has not yet been determined. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence and transcripts to make the sequence consistent with the reference genome assembly. The genomic coordites used for the transcript record were based on alignments.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DIRC2 (2 products)

Catalog No. Species Pres. Purity   Source  

DIRC2

DIRC2 Human Purified
  Abnova Taiwan Corp.

DIRC2

DIRC2 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn