TA339698 C1D antibody

Rabbit Polyclonal Anti-C1D Antibody

See related secondary antibodies

Search for all "C1D"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat C1D

Product Description for C1D

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat C1D.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C1D

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Nuclear nucleic acid-binding protein C1D
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13901
Immunogen:
The immunogen for anti-C1D antibody: synthetic peptide directed towards the N terminal of human C1D. Synthetic peptide located within the following region: AGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLE.
GeneID:
10438
Application WB
Background C1D is a D binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. C1D is thought to regulate TRAX/Translin complex formation. The protein encoded by this gene is a D binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several altertively spliced transcript variants of this gene have been described, but the full length ture of some of these variants has not been determined.The protein encoded by this gene is a D binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several altertively spliced transcript variants of this gene have been described, but the full length ture of some of these variants has not been determined.The protein encoded by this gene is a D binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several altertively spliced transcript variants of this gene have been described, but the full length ture of some of these variants has not been determined.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C1D (10 products)

Catalog No. Species Pres. Purity   Source  

C1D (transcript variant 1)

C1D Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

C1D (transcript variant 2)

C1D Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

C1D (1-141, His-tag)

C1D Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

C1D (1-141, His-tag)

C1D Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

C1D

C1D Human in vitro transl.
  Abnova Taiwan Corp.

C1D

C1D Human Purified
  Abnova Taiwan Corp.

C1D

C1D Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

C1D

C1D Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

C1D

C1D Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

C1D

C1D Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for C1D (4 products)

Catalog No. Species Pres. Purity   Source  

C1D 293T Cell Transient Overexpression Lysate(Denatured)

C1D 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

C1D Lysate

Western Blot: C1D Lysate [NBL1-08284] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1D Protein
  Novus Biologicals Inc.

C1D Lysate

Western Blot: C1D Lysate [NBL1-08285] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C1D Protein
  Novus Biologicals Inc.

C1D overexpression lysate

C1D overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn