TA339726 MBTD1 antibody

Rabbit Polyclonal Anti-MBTD1 Antibody

See related secondary antibodies

Search for all "MBTD1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish MBTD1

Product Description for MBTD1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish MBTD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MBTD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MBT domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q05BQ5
Immunogen:
The immunogen for Anti-MBTD1 antibody is: synthetic peptide directed towards the N-terminal region of Human MBTD1. Synthetic peptide located within the following region: PFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHM.
GeneID:
54799
Application WB
Background MBTD1 is a putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptiolly repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. It is specifically binds to monomethylated and dimethylated 'Lys-20' on histone H4.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MBTD1 (1 products)

Catalog No. Species Pres. Purity   Source  

MBTD1

MBTD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn