TA339730 CDCA4 antibody

Rabbit Polyclonal Anti-CDCA4 Antibody

See related secondary antibodies

Search for all "CDCA4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish CDCA4

Product Description for CDCA4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish CDCA4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CDCA4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cell division cycle-associated protein 4, HEPP, Hematopoietic progenitor protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BXL8
Immunogen:
The immunogen for anti-CDCA4 antibody: synthetic peptide directed towards the middle region of human CDCA4. Synthetic peptide located within the following region: SSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLD.
GeneID:
55038
Application WB
Background The function of this gene is not known, but its existence is supported by mRs and EST data. A similar gene in mice was found to be expressed preferentially in hematopoietic progenitors and mature blood cells.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CDCA4 (3 products)

Catalog No. Species Pres. Purity   Source  

CDCA4 (full length, N-term HIS tag, transcript variant 1)

CDCA4 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

CDCA4

CDCA4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CDCA4

CDCA4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CDCA4 (2 products)

Catalog No. Species Pres. Purity   Source  

CDCA4 Lysate

Western Blot: CDCA4 Lysate [NBL1-09017] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CDCA4
  Novus Biologicals Inc.

CDCA4 Lysate

Western Blot: CDCA4 Lysate [NBL1-09018] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CDCA4.
  Novus Biologicals Inc.
  • LinkedIn