TA339745 ZFYVE28 antibody

Rabbit Polyclonal Anti-ZFYVE28 Antibody

See related secondary antibodies

Search for all "ZFYVE28"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZFYVE28

Product Description for ZFYVE28

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZFYVE28.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFYVE28

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1643, Zinc finger FYVE domain-containing protein 28
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HCC9
Immunogen:
The immunogen for anti-ZFYVE28 antibody: synthetic peptide directed towards the N terminal of human ZFYVE28. Synthetic peptide located within the following region: LTRSLEDVRGALRDQALRDLNTYTEKMREALRHFDVLFAEFELSYVSAMV.
GeneID:
57732
Application WB
Background ZFYVE28 contains 1 FYVE-type zinc finger. The exact function of ZFYVE28 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZFYVE28 (2 products)

Catalog No. Species Pres. Purity   Source  

ZFYVE28

ZFYVE28 Human Purified
  Abnova Taiwan Corp.

ZFYVE28

ZFYVE28 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZFYVE28 (1 products)

Catalog No. Species Pres. Purity   Source  

ZFYVE28 293T Cell Transient Overexpression Lysate(Denatured)

ZFYVE28 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn