TA339754 ANKRA2 antibody

Rabbit Polyclonal Anti-Ankra2 Antibody

See related secondary antibodies

Search for all "ANKRA2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish ANKRA2

Product Description for ANKRA2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish ANKRA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ANKRA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ankyrin repeat family A protein 2, RFXANK-like 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99PE2
Immunogen:
The immunogen for Anti-Ankra2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ankra2. Synthetic peptide located within the following region: VAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKA.
GeneID:
68558
Application WB
Background Ankra2 may facilitate endocytosis by linking megalin to components of the cytoskeleton or endocytic machinery.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn