TA339760 BTBD4 / ZNF340 antibody

Rabbit Polyclonal Anti-ZBTB46 Antibody

See related secondary antibodies

Search for all "BTBD4 / ZNF340"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat BTBD4 / ZNF340

Product Description for BTBD4 / ZNF340

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat BTBD4 / ZNF340.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTBD4 / ZNF340

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB/POZ domain-containing protein 4, ZBTB46, Zinc finger and BTB domain-containing protein 46, Zinc finger protein 340
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UZ6
Immunogen:
The immunogen for anti-ZBTB46 antibody: synthetic peptide directed towards the middle region of human ZBTB46. Synthetic peptide located within the following region: DSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRI.
GeneID:
140685
Application WB
Background ZBTB46 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. ZBTB46 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BTBD4 / ZNF340 (2 products)

Catalog No. Species Pres. Purity   Source  

BTBD4 / ZNF340

BTBD4 / ZNF340 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

BTBD4 / ZNF340

BTBD4 / ZNF340 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for BTBD4 / ZNF340 (1 products)

Catalog No. Species Pres. Purity   Source  

BTBD4 293T Cell Transient Overexpression Lysate(Denatured)

BTBD4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn