TA339763 MED25 antibody

Rabbit Polyclonal Anti-MED25 Antibody

See related secondary antibodies

Search for all "MED25"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish MED25

TA339763

More Views

  • TA339763

Product Description for MED25

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish MED25.
Presentation: Purified
Product is tested for ChIP assay, Western blot / Immunoblot.

Properties for MED25

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ACID1, ARC92, Activator interaction domain-containing protein 1, Activator-recruited cofactor 92 kDa component, Mediator complex subunit 25, Mediator of RNA polymerase II transcription subunit 25, PTOV2, p78
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rt, Ze
Applications ChIP, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q71SY5
Immunogen:
The immunogen for anti-MED25 antibody: synthetic peptide directed towards the N terminal of human MED25. Synthetic peptide located within the following region: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV.
GeneID:
81857
Application WB
CHIP
Background This gene encodes a component of the transcriptiol coactivator complex termed the Mediator complex. This complex is required for transcription of most R polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MED25 (1 products)

Catalog No. Species Pres. Purity   Source  

MED25

MED25 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for MED25 (1 products)

Catalog No. Species Pres. Purity   Source  

MED25 overexpression lysate

MED25 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn