TA339768 PHF20L1 antibody

Rabbit Polyclonal Anti-PHF20L1 Antibody

See related secondary antibodies

Search for all "PHF20L1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PHF20L1

Product Description for PHF20L1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PHF20L1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PHF20L1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CGI-72, PHD finger protein 20-like protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8MW92
Immunogen:
The immunogen for anti-PHF20L1 antibody: synthetic peptide directed towards the N terminal of human PHF20L1. Synthetic peptide located within the following region: AAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKE.
GeneID:
51105
Application WB
Background The exact function of PHF20L1 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PHF20L1 (2 products)

Catalog No. Species Pres. Purity   Source  

PHF20L1

PHF20L1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PHF20L1

PHF20L1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PHF20L1 (1 products)

Catalog No. Species Pres. Purity   Source  

PHF20L1 293T Cell Transient Overexpression Lysate(Denatured)

PHF20L1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn