TA339808 ZNF781 antibody

Rabbit Polyclonal Anti-ZNF781 Antibody

See related secondary antibodies

Search for all "ZNF781"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF781

Product Description for ZNF781

Rabbit anti Human ZNF781.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF781

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 781
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N8C0
Immunogen:
The immunogen for anti-ZNF781 antibody: synthetic peptide directed towards the N terminal of human ZNF781. Synthetic peptide located within the following region: QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQH.
GeneID:
163115
Application WB
Background ZNF781 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 4 C2H2-type zinc fingers. ZNF781 may be involved in transcriptiol regulation. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functiol homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis. Altertive splicing results in at least two different transcript variants, one which is protein-coding and one which is probably not protein-coding.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn