TA339809 DCP1B antibody

Rabbit Polyclonal Anti-DCP1B Antibody

See related secondary antibodies

Search for all "DCP1B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DCP1B

Product Description for DCP1B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat DCP1B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DCP1B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms mRNA-decapping enzyme 1B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IZD4
Immunogen:
The immunogen for anti-DCP1B antibody: synthetic peptide directed towards the N terminal of human DCP1B. Synthetic peptide located within the following region: TLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIR.
GeneID:
196513
Application WB
Background DCP1B may play a role in the degradation of mRs, both in normal mR turnover and in nonsense-mediated mR decay. It may remove the 7-methyl guanine cap structure from mR molecules, yielding a 5'-phosphorylated mR fragment and 7m-GDP.DCP1B is a core component of the mR decapping complex, a key factor in the regulation of mR decay (Lykke-Andersen, 2002 [PubMed 12417715]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-844 AY146652.1 1-844 845-2079 BC015368.2 379-1613 2080-2105 AW204088.1 3-28 c
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DCP1B (3 products)

Catalog No. Species Pres. Purity   Source  

DCP1B

DCP1B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DCP1B

DCP1B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DCP1B

DCP1B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DCP1B (3 products)

Catalog No. Species Pres. Purity   Source  

DCP1B 293T Cell Transient Overexpression Lysate(Denatured)

DCP1B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DCP1B Lysate

Western Blot: DCP1B Lysate [NBL1-09746] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DCP1B
  Novus Biologicals Inc.

DCP1B overexpression lysate

DCP1B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn