TA339821 ZFYVE1 antibody

Rabbit Polyclonal Anti-ZFYVE1 Antibody

See related secondary antibodies

Search for all "ZFYVE1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZFYVE1

Product Description for ZFYVE1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZFYVE1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFYVE1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DFCP1, Double FYVE-containing protein 1, KIAA1589, PP10436, SR3, TAFF1, Tandem FYVE fingers-1, ZNFN2A1, Zinc finger FYVE domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HBF4
Immunogen:
The immunogen for anti-ZFYVE1 antibody: synthetic peptide directed towards the N terminal of human ZFYVE1. Synthetic peptide located within the following region: GVPHEAKSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSASTDSPWMGL.
GeneID:
53349
Application WB
Background ZFYVE1 contains two zinc-binding FYVE domains in tandem. This protein binds to phosphatidylinositol-3-phosphate (PtdIns3P) through its FYVE-type zinc finger. It displays a predomintly Golgi, endoplasmic reticulum and vesicular distribution. Altertively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes. The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell sigling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains two zinc-binding FYVE domains in tandem. This protein displays a predomintly Golgi, endoplasmic reticulum and vesicular distribution. Altertively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZFYVE1 (4 products)

Catalog No. Species Pres. Purity   Source  

ZFYVE1

ZFYVE1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZFYVE1

ZFYVE1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZFYVE1

ZFYVE1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZFYVE1

ZFYVE1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZFYVE1 (3 products)

Catalog No. Species Pres. Purity   Source  

ZFYVE1 293T Cell Transient Overexpression Lysate(Denatured)

ZFYVE1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZFYVE1 Lysate

Western Blot: ZFYVE1 Lysate [NBL1-18026] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZFYVE1
  Novus Biologicals Inc.

ZFYVE1 overexpression lysate

ZFYVE1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn