TA339823 ZNF680 antibody

Rabbit Polyclonal Anti-ZNF680 Antibody

See related secondary antibodies

Search for all "ZNF680"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF680

Product Description for ZNF680

Rabbit anti Human ZNF680.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF680

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 680
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 62 kDa (530 aa)
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NEM1
Immunogen:
A synthetic peptide directed towards the N-terminal region of human ZNF680
AA Sequence:
RGYGKCGHENLQLRISCKSVDESKVFKEGYNELNQCLRTTQSKIFQCDKY
GeneID:
340252
Application Western blotting: 0.2-1.0 ug/ml.
Background Zinc finger protein 680, belonging to the krueppel C2H2-type zinc-finger protein family, contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF680 may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004).
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF680 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF680

ZNF680 Human Purified
  Abnova Taiwan Corp.

ZNF680

ZNF680 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZNF680 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF680 293T Cell Transient Overexpression Lysate(Denatured)

ZNF680 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn