TA339856 ZNF12 antibody

Rabbit Polyclonal Anti-ZNF12 Antibody

See related secondary antibodies

Search for all "ZNF12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human ZNF12

Product Description for ZNF12

Rabbit anti Bovine, Equine, Human ZNF12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GIOT-3, GIOT3, Gonadotropin-inducible ovary transcription repressor 3, KOX3, ZNF325, Zinc finger protein 325, Zinc finger protein KOX3
Presentation Purified
Reactivity Bov, Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P17014
Immunogen:
The immunogen for Anti-ZNF12 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF12. Synthetic peptide located within the following region: EWQQLDPEQKITYRDVMLENYSNLVSVGYHIIKPDVISKLEQGEEPWIVE.
GeneID:
7559
Application WB
Background This gene is a member of the krueppel C2H2-type zinc-finger protein family and encodes a protein with eight C2H2-type zinc fingers and a KRAB domain. This nuclear protein is involved in developmental control of gene expression. Alterte transcriptiol splice variants, encoding different isoforms, have been characterized.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF12 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF12

ZNF12 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF12

ZNF12 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF12 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF12 overexpression lysate

ZNF12 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn