TA339954 PM20D2 antibody

Rabbit Polyclonal Anti-PM20D2 Antibody

See related secondary antibodies

Search for all "PM20D2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PM20D2

Product Description for PM20D2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PM20D2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PM20D2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Aminoacylase-1-like protein 2, Peptidase M20 domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IYS1
Immunogen:
The immunogen for anti-PM20D2 antibody: synthetic peptide directed towards the middle region of human PM20D2. Synthetic peptide located within the following region: HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS.
GeneID:
135293
Application WB
Background PM20D2 belongs to the peptidase M20A family. The function of PM20D2 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn