TA339964 SORBS1 / Ponsin antibody

Rabbit Polyclonal Anti-Sorbs1 Antibody

See related secondary antibodies

Search for all "SORBS1 / Ponsin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SORBS1 / Ponsin

Product Description for SORBS1 / Ponsin

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SORBS1 / Ponsin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SORBS1 / Ponsin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CAP, KIAA0894, KIAA1296, SH3D5, SH3P12, Sorbin and SH3 domain-containing protein 1, c-Cbl-associated protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q62417
Immunogen:
The immunogen for Anti-Sorbs1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sorbs1. Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC.
GeneID:
20411
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn