Alpha-1-antichymotrypsin / ACT - TA339986

Product Description for Alpha-1-antichymotrypsin / ACT

Rabbit anti Human, Mouse, Rat Alpha-1-antichymotrypsin / ACT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Alpha-1-antichymotrypsin / ACT

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	AACT, Cell growth-inhibiting gene 24/25 protein, GIG24, GIG25, SERPINA3
Presentation	Purified
Reactivity	Hu, Ms, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: P01011 Immunogen: The immunogen for anti-SERPINA3 antibody: synthetic peptide directed towards the middle region of human SERPINA3. Synthetic peptide located within the following region: FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL. GeneID: 12
Application	WB
Background	SERPI3 is a plasma protease inhibitor and member of the serine protease inhibitor class. Polymorphisms in this protein appear to be tissue specific and influence protease targeting. Variations in this protein's sequence have been implicated in Alzheimer's disease, and deficiency of this protein has been associated with liver disease.The protein encoded by this gene is a plasma protease inhibitor and member of the serine protease inhibitor class. Polymorphisms in this protein appear to be tissue specific and influence protease targeting. Variations in this protein's sequence have been implicated in Alzheimer's disease, and deficiency of this protein has been associated with liver disease. Mutations have been identified in patients with Parkinson disease and chronic obstructive pulmory disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format	Purification: Affinity Purified Buffer System: 1X PBS with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Alpha-1-antichymotrypsin / ACT (15 products)

Catalog No.	Species	Pres.	Purity	Source
TP720681	Alpha-1-antichymotrypsin / ACT
	Human		> 95 % Preparation: . Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	10 µg / €299.00
					OriGene Technologies, Inc.
AR09303PU-L	Alpha-1-antichymotrypsin / ACT (24-423, His-tag)
	Human	Purified	> 95 % by SDS – PAGE	E. coli	0.5 mg / €720.00
					OriGene Technologies GmbH
AR09303PU-N	Alpha-1-antichymotrypsin / ACT (24-423, His-tag)
	Human	Purified	> 95 % by SDS – PAGE	E. coli	0.1 mg / €290.00
					OriGene Technologies GmbH
AR10116PU-L	Alpha-1-antichymotrypsin / ACT
	Human	Purified
					OriGene Technologies GmbH
AR10116PU-N	Alpha-1-antichymotrypsin / ACT
	Human	Purified
					OriGene Technologies GmbH
AR10116PU-S	Alpha-1-antichymotrypsin / ACT
	Human	Purified
					OriGene Technologies GmbH
BA042X	Alpha-1-antichymotrypsin / ACT
	Human	Purified	> 95 %	Plasma	1 mg / €600.00
					OriGene Technologies GmbH
H00000012-P01-10	Alpha-1-antichymotrypsin / ACT
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00000012-P01-25	Alpha-1-antichymotrypsin / ACT
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00000012-P02	Alpha-1-antichymotrypsin / ACT
	Human	Purified
					Abnova Taiwan Corp.
H00000012-P02-10	Alpha-1-antichymotrypsin / ACT
	Human	Purified
					Abnova Taiwan Corp.
H00000012-P02-25	Alpha-1-antichymotrypsin / ACT
	Human	Purified
					Abnova Taiwan Corp.
P4947	Alpha-1-antichymotrypsin / ACT
	Human
					Abnova Taiwan Corp.
P159-5	Alpha-1-antichymotrypsin / ACT
	Human		> 90 %	Serum
					BBI Solutions
NBP1-30283	Alpha-1-antichymotrypsin / ACT

					Novus Biologicals Inc.

Positive controls for Alpha-1-antichymotrypsin / ACT (1 products)

Catalog No.	Species
H00000012-T01	SERPINA3 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.

Recommended Secondary Antibodies for Alpha-1-antichymotrypsin / ACT (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH