TA339998 AP1 complex subunit gamma-1 / AP1G1 antibody

Rabbit Polyclonal Anti-AP1G1 Antibody

See related secondary antibodies

Search for all "AP1 complex subunit gamma-1 / AP1G1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat AP1 complex subunit gamma-1 / AP1G1

TA339998

More Views

  • TA339998
  • TA339998
  • TA339998

Product Description for AP1 complex subunit gamma-1 / AP1G1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat AP1 complex subunit gamma-1 / AP1G1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for AP1 complex subunit gamma-1 / AP1G1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADTG, Adapter-related protein complex 1 subunit gamma-1, Adaptor protein complex AP-1 subunit gamma-1, CLAPG1, Clathrin assembly protein complex 1 gamma-1 large chain, Golgi adaptor HA1/AP1, gamma 1 Adaptin, gamma Adaptin
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43747
Immunogen:
The immunogen for anti-AP1G1 antibody: synthetic peptide directed towards the C terminal of human AP1G1. Synthetic peptide located within the following region: DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS.
GeneID:
164
Application WB
Background Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules med alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. AP1G1 is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules med alpha, beta-, beta prime- and gamma- adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family. Two transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for AP1 complex subunit gamma-1 / AP1G1 (1 products)

Catalog No. Species Pres. Purity   Source  

AP1 complex subunit gamma-1 / AP1G1 (transcript variant 1)

AP1 complex subunit gamma-1 / AP1G1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for AP1 complex subunit gamma-1 / AP1G1 (1 products)

Catalog No. Species Pres. Purity   Source  

Gamma Adaptin Lysate

Western Blot: Gamma Adaptin Lysate [NBL1-07575] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AP1G1 Protein
  Novus Biologicals Inc.
  • LinkedIn