TA340003 CKAP1 / TBCB antibody

Rabbit Polyclonal Anti-Tbcb Antibody

See related secondary antibodies

Search for all "CKAP1 / TBCB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CKAP1 / TBCB

Product Description for CKAP1 / TBCB

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat CKAP1 / TBCB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CKAP1 / TBCB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CG22, CKAPI, Cytoskeleton-associated protein 1, Cytoskeleton-associated protein CKAPI, Tubulin-folding cofactor B, Tubulin-specific chaperone B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9D1E6
Immunogen:
The immunogen for anti-Tbcb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FKCKLELVVGSPASCMELELYGADDKFYSKLDQEDALLGSYPVDDGCRIH.
GeneID:
66411
Application WB
Background Tbcb binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. It may function as a negative regulator of axol growth.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn