TA340011 CSNK1G2 antibody

Rabbit Polyclonal Anti-CSNK1G2 Antibody

See related secondary antibodies

Search for all "CSNK1G2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CSNK1G2

TA340011

More Views

  • TA340011

Product Description for CSNK1G2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CSNK1G2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CSNK1G2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CKI-gamma 2, Casein kinase I isoform gamma-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P78368
Immunogen:
The immunogen for anti-CSNK1G2 antibody: synthetic peptide directed towards the middle region of human CSNK1G2. Synthetic peptide located within the following region: SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR.
GeneID:
1455
Application WB
Background CSNK1G2 belongs to the protein kise superfamily, CK1 Ser/Thr protein kise family, casein kise I subfamily. It contains 1 protein kise domain. Casein kises are operatiolly defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. It participates in Wnt sigling.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CSNK1G2 (6 products)

Catalog No. Species Pres. Purity   Source  

CSNK1G2

CSNK1G2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CSNK1G2

CSNK1G2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CSNK1G2

CSNK1G2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CSNK1G2

CSNK1G2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CSNK1G2

CSNK1G2 Human
  Abnova Taiwan Corp.

CSNK1G2

CSNK1G2 Human
  Abnova Taiwan Corp.

Positive controls for CSNK1G2 (3 products)

Catalog No. Species Pres. Purity   Source  

Casein Kinase 1 gamma 2 Lysate

Western Blot: Casein Kinase 1 gamma 2 Lysate [NBL1-09533] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CSNK1G2
  Novus Biologicals Inc.

CSNK1G2 293T Cell Transient Overexpression Lysate(Denatured)

CSNK1G2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CSNK1G2 overexpression lysate

CSNK1G2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn