RABEPK (N-term) - TA340082 | acris-antibodies.com

Product Description for RABEPK

Rabbit anti Human RABEPK.
Properties: (N-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	40 kDa Rab9 effector protein, RAB9P40, Rab9 effector protein with kelch motifs
Presentation	Aff - Purified
Reactivity	Hu
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Molecular weight	RABEPK: 40 kDa
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q7Z6M1 Immunogen: Synthetic peptide directed towards the N terminal of human RABEPK AA Sequence: `SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL` GeneID: 10244
Property	N-term
Application	Western blotting (0.2 - 1 µg/ml).
Background	RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.
General Readings	"Active PIKfyve associates with and promotes the membrane attachment of the late endosome-to-trans-Golgi network transport factor Rab9 effector p40." Ikonomov O.C., Sbrissa D., Mlak K., Deeb R., Fligger J., Soans A., Finley R.L. Jr., Shisheva A. J. Biol. Chem. 278:50863-50871(2003) [PubMed: 14530284]
Storage	Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format	Purification: Immunoaffinity column State: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Aff - Purified
Species Reactivity	Species reactivity (tested): Human.

Catalog No.	Species	Pres.	Purity	Source
TP308763	RABEPK
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
H00010244-P01-10	RABEPK
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00010244-P01-25	RABEPK
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00010244-Q01-10	RABEPK
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00010244-Q01-25	RABEPK
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
10-288-22319F	RABEPK
	Human	Purified	95 %	E. coli
					GenWay Biotech Inc.
10-288-22319F-50	RABEPK
	Human	Purified	95 %	E. coli
					GenWay Biotech Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH