TA340082 RABEPK (N-term) antibody

Rabbit Polyclonal Anti-RABEPK Antibody

See related secondary antibodies

Search for all "RABEPK"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human RABEPK

Product Description for RABEPK

Rabbit anti Human RABEPK.
Properties: (N-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RABEPK

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 40 kDa Rab9 effector protein, RAB9P40, Rab9 effector protein with kelch motifs
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight RABEPK: 40 kDa
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z6M1
Immunogen:
Synthetic peptide directed towards the N terminal of human RABEPK
AA Sequence:
SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL
GeneID:
10244
Property N-term
Application

Western blotting  (0.2 - 1 µg/ml).

Background RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.
General Readings "Active PIKfyve associates with and promotes the membrane attachment of the late endosome-to-trans-Golgi network transport factor Rab9 effector p40." Ikonomov O.C., Sbrissa D., Mlak K., Deeb R., Fligger J., Soans A., Finley R.L. Jr., Shisheva A. J. Biol. Chem. 278:50863-50871(2003) [PubMed: 14530284]
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for RABEPK (7 products)

Catalog No. Species Pres. Purity   Source  

RABEPK

RABEPK Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RABEPK

RABEPK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RABEPK

RABEPK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RABEPK

RABEPK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RABEPK

RABEPK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RABEPK

RABEPK Human Purified 95 % E. coli
  GenWay Biotech Inc.

RABEPK

RABEPK Human Purified 95 % E. coli
  GenWay Biotech Inc.
  • LinkedIn