TA340092 RAPGEF3 antibody

Rabbit Polyclonal Anti-RAPGEF3 Antibody

See related secondary antibodies

Search for all "RAPGEF3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat RAPGEF3

Product Description for RAPGEF3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat RAPGEF3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAPGEF3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CGEF1, EPAC, EPAC 1, EPAC1, Exchange factor directly activated by cAMP 1, Exchange protein directly activated by cAMP 1, Rap guanine nucleotide exchange factor 3, Rap1 guanine-nucleotide-exchange factor directly activated by cAMP, cAMP-GEFI, cAMP-regulated guanine nucleotide exchange factor I
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95398
Immunogen:
The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the N terminal of human RAPGEF3. Synthetic peptide located within the following region: RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME.
GeneID:
10411
Application WB
Background The function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RAPGEF3 (6 products)

Catalog No. Species Pres. Purity   Source  

RAPGEF3 (transcript variant 2)

RAPGEF3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RAPGEF3 (transcript variant 3)

RAPGEF3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RAPGEF3

RAPGEF3 Human Purified
  Abnova Taiwan Corp.

RAPGEF3

RAPGEF3 Human Purified
  Abnova Taiwan Corp.

RAPGEF3

RAPGEF3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAPGEF3

RAPGEF3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RAPGEF3 (1 products)

Catalog No. Species Pres. Purity   Source  

RAPGEF3 Lysate

Western Blot: RAPGEF3 Lysate [NBL1-15152] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RAPGEF3
  Novus Biologicals Inc.
  • LinkedIn