TA340123 SDCCAG8 antibody

Rabbit Polyclonal Anti-SDCCAG8 Antibody

See related secondary antibodies

Search for all "SDCCAG8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SDCCAG8

Product Description for SDCCAG8

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SDCCAG8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SDCCAG8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Antigen NY-CO-8, CCCAP, Centrosomal colon cancer autoantigen protein, Serologically defined colon cancer antigen 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86SQ7
Immunogen:
The immunogen for anti-SDCCAG8 antibody: synthetic peptide directed towards the N terminal of human SDCCAG8. Synthetic peptide located within the following region: HEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLE.
GeneID:
10806
Application WB
Background The exact function of SDCCAG8 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SDCCAG8 (2 products)

Catalog No. Species Pres. Purity   Source  

SDCCAG8

SDCCAG8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SDCCAG8

SDCCAG8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SDCCAG8 (1 products)

Catalog No. Species Pres. Purity   Source  

SDCCAG8 293T Cell Transient Overexpression Lysate(Denatured)

SDCCAG8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn