TA340155 PRSS23 antibody

Rabbit Polyclonal Anti-PRSS23 Antibody

See related secondary antibodies

Search for all "PRSS23"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PRSS23

Product Description for PRSS23

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PRSS23.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRSS23

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Serine protease 23, ZSIG13
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95084
Immunogen:
The immunogen for anti-PRSS23 antibody: synthetic peptide directed towards the C terminal of human PRSS23. Synthetic peptide located within the following region: VSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPG.
GeneID:
11098
Application WB
Background This gene encodes a member of the trypsin family of serine proteases. Mouse studies found a decrease of mR levels after ovulation was induced. This gene seems to be highly conserved in vertebrates and may be an important ovarian protease.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PRSS23 (3 products)

Catalog No. Species Pres. Purity   Source  

PRSS23

PRSS23 Human
  Abnova Taiwan Corp.

PRSS23

PRSS23 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

PRSS23

PRSS23 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.
  • LinkedIn