TA340165 Calcium-binding protein p22 antibody

Rabbit Polyclonal Anti-CHP1 Antibody

See related secondary antibodies

Search for all "Calcium-binding protein p22"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Calcium-binding protein p22

TA340165

More Views

  • TA340165

Product Description for Calcium-binding protein p22

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Calcium-binding protein p22.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Calcium-binding protein p22

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Calcineurin B homolog, Calcineurin homologous protein, Calcium-binding protein CHP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99653
Immunogen:
The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM.
GeneID:
11261
Application WB
IHC
Background This gene encodes a phosphoprotein that binds to the +/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Calcium-binding protein p22 (7 products)

Catalog No. Species Pres. Purity   Source  

Calcium-binding protein p22

Calcium-binding protein p22 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Calcium-binding protein p22 (1-195, His-tag)

Calcium-binding protein p22 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €720.00
  OriGene Technologies GmbH

Calcium-binding protein p22 (1-195, His-tag)

Calcium-binding protein p22 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €290.00
  OriGene Technologies GmbH

Calcium-binding protein p22

Calcium-binding protein p22 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Calcium-binding protein p22

Calcium-binding protein p22 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Calcium-binding protein p22

Calcium-binding protein p22 Human Purified
  Novus Biologicals Inc.

Calcium-binding protein p22

Calcium-binding protein p22 Human Purified
  Novus Biologicals Inc.

Positive controls for Calcium-binding protein p22 (1 products)

Catalog No. Species Pres. Purity   Source  

Calcium-binding-protein-P22 Lysate

Western Blot: Calcium-binding-protein-P22 Lysate [NBL1-09168] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CHP
  Novus Biologicals Inc.
  • LinkedIn