TA340190 Gamma-crystallin C antibody

Rabbit Polyclonal Anti-CRYGC Antibody

See related secondary antibodies

Search for all "Gamma-crystallin C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Rabbit, Rat Gamma-crystallin C

Product Description for Gamma-crystallin C

Rabbit anti Bovine, Canine, Equine, Human, Rabbit, Rat Gamma-crystallin C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Gamma-crystallin C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CRYG3, CRYGC, Gamma-C-crystallin, Gamma-crystallin 2-1, Gamma-crystallin 3
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P07315
Immunogen:
The immunogen for anti-CRYGC antibody: synthetic peptide directed towards the middle region of human CRYGC. Synthetic peptide located within the following region: GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE.
GeneID:
1420
Application WB
Background Crystallins are the domint structural components of the vertebrate eye lens.Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-termil extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and termil extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Gamma-crystallin C (6 products)

Catalog No. Species Pres. Purity   Source  

Gamma-crystallin C

Gamma-crystallin C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Gamma-crystallin C (1-174, His-tag)

Gamma-crystallin C Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Gamma-crystallin C (1-174, His-tag)

Gamma-crystallin C Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Gamma-crystallin C

Gamma-crystallin C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Gamma-crystallin C

Gamma-crystallin C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Gamma-crystallin C

Gamma-crystallin C Human
  Abnova Taiwan Corp.

Positive controls for Gamma-crystallin C (2 products)

Catalog No. Species Pres. Purity   Source  

CRYGC overexpression lysate

CRYGC overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

gamma C Crystallin Lysate

Western Blot: gamma C Crystallin Lysate [NBL1-09501] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CRYGC
  Novus Biologicals Inc.
  • LinkedIn