TA340206 FBXW10 antibody

Rabbit Polyclonal Anti-FBXW10 Antibody

See related secondary antibodies

Search for all "FBXW10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat FBXW10

Product Description for FBXW10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat FBXW10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FBXW10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F-box and WD-40 domain-containing protein 10, F-box/WD repeat-containing protein 10, Ubiquitin ligase-specificity factor
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5XX13
Immunogen:
The immunogen for anti-FBXW10 antibody: synthetic peptide directed towards the middle region of human FBXW10. Synthetic peptide located within the following region: RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD.
GeneID:
10517
Application WB
Background Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitition targets through other protein interaction domains. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitition targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn