TA340225 C8orf34 antibody

Rabbit Polyclonal Anti-C8orf34 Antibody

See related secondary antibodies

Search for all "C8orf34"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish C8orf34

Product Description for C8orf34

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish C8orf34.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C8orf34

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C8orf34, VEST1, Vest-1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q49A92
Immunogen:
The immunogen for anti-C8orf34 antibody: synthetic peptide directed towards the N terminal of human C8orf34. Synthetic peptide located within the following region: MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK.
GeneID:
116328
Application WB
Background The exact function of C8orf34 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C8orf34 (1 products)

Catalog No. Species Pres. Purity   Source  

C8orf34 overexpression lysate

C8orf34 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn