TA340228 Arginine decarboxylase / ADC antibody

Rabbit Polyclonal Anti-ADC Antibody

See related secondary antibodies

Search for all "Arginine decarboxylase / ADC"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast Arginine decarboxylase / ADC

Product Description for Arginine decarboxylase / ADC

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast Arginine decarboxylase / ADC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Arginine decarboxylase / ADC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARGDC, KIAA1945, ODC-paralogue, ODCP, Ornithine decarboxylase-like protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Sh, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96A70
Immunogen:
The immunogen for Anti-ADC antibody is: synthetic peptide directed towards the C-terminal region of Human ADC. Synthetic peptide located within the following region: AELGRYYVTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGV.
GeneID:
113451
Application WB
Background ADC decarboxylates L-arginine to agmatine. Truncated splice isoforms probably lack activity.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn