TA340246 C20orf141 antibody

Rabbit Polyclonal Anti-C20orf141 Antibody

See related secondary antibodies

Search for all "C20orf141"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat C20orf141

Product Description for C20orf141

Rabbit anti Bovine, Canine, Human, Mouse, Rat C20orf141.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C20orf141

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C20orf141, chromosome 20 open reading frame 141
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUB4
Immunogen:
The immunogen for anti-C20orf141 antibody: synthetic peptide directed towards the middle region of human C20orf141. Synthetic peptide located within the following region: HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG.
GeneID:
128653
Application WB
Background The exact function of C20orf141 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C20orf141 (3 products)

Catalog No. Species Pres. Purity   Source  

C20orf141

C20orf141 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

C20orf141

C20orf141 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

C20orf141

C20orf141 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for C20orf141 (2 products)

Catalog No. Species Pres. Purity   Source  

C20ORF141 Lysate

Western Blot: C20ORF141 Lysate [NBL1-08362] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C20orf141 Protein
  Novus Biologicals Inc.

C20orf141 overexpression lysate

C20orf141 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn