TA340253 DUSP19 antibody

Rabbit Polyclonal Anti-DUSP19 Antibody

See related secondary antibodies

Search for all "DUSP19"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat DUSP19

Product Description for DUSP19

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat DUSP19.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DUSP19

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DUSP17, Dual specificity protein phosphatase 19, LMW-DSP3, Protein phosphatase SKRP1, SAPK pathway-regulating phosphatase 1, SKRP1, Stress-activated protein kinase pathway-regulating phosphatase 1, TS-DSP1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WTR2
Immunogen:
The immunogen for anti-DUSP19 antibody: synthetic peptide directed towards the C terminal of human DUSP19. Synthetic peptide located within the following region: SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS.
GeneID:
142679
Application WB
Background DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DUSP19 (4 products)

Catalog No. Species Pres. Purity   Source  

DUSP19 (transcript variant 1)

DUSP19 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DUSP19 (65-217, His-tag)

DUSP19 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

DUSP19 (65-217, His-tag)

DUSP19 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

DUSP19

DUSP19 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DUSP19 (3 products)

Catalog No. Species Pres. Purity   Source  

DUSP19 293T Cell Transient Overexpression Lysate(Denatured)

DUSP19 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DUSP19 overexpression lysate

DUSP19 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

DUSP19 overexpression lysate

DUSP19 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn