TA340291 FAM83F antibody

Rabbit Polyclonal Anti-FAM83F Antibody

See related secondary antibodies

Search for all "FAM83F"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FAM83F

Product Description for FAM83F

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FAM83F.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM83F

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NEG4
Immunogen:
The immunogen for anti-FAM83F antibody: synthetic peptide directed towards the middle region of human FAM83F. Synthetic peptide located within the following region: FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP.
GeneID:
113828
Application WB
Background The exact function of FAM83F remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM83F (1 products)

Catalog No. Species Pres. Purity   Source  

FAM83F overexpression lysate

FAM83F overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn