TA340295 IQCD antibody

Rabbit Polyclonal Anti-IQCD Antibody

See related secondary antibodies

Search for all "IQCD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human IQCD

Product Description for IQCD

Rabbit anti Human IQCD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IQCD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IQ domain-containing protein D
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96DY2
Immunogen:
The immunogen for anti-IQCD antibody: synthetic peptide directed towards the N terminal of human IQCD. Synthetic peptide located within the following region: ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR.
GeneID:
115811
Application WB
Background IQCD contains 1 IQ domain. The function of the IQCD protein is not known.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IQCD (3 products)

Catalog No. Species Pres. Purity   Source  

IQCD (full length, N-term HIS tag)

IQCD Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

IQCD

IQCD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IQCD

IQCD Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for IQCD (2 products)

Catalog No. Species Pres. Purity   Source  

IQCD 293T Cell Transient Overexpression Lysate(Denatured)

IQCD 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IQCD Lysate

Western Blot: IQCD Lysate [NBL1-12020] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IQCD
  Novus Biologicals Inc.
  • LinkedIn