TA340298 WDR92 / Monad antibody

Rabbit Polyclonal Anti-Wdr92 Antibody

See related secondary antibodies

Search for all "WDR92 / Monad"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish WDR92 / Monad

Product Description for WDR92 / Monad

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish WDR92 / Monad.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDR92 / Monad

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms WD repeat-containing protein 92, WD repeat-containing protein Monad
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8BGF3
Immunogen:
The immunogen for anti-Wdr92 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NMEPAQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMSLRW.
GeneID:
103784
Application WB
Background Wdr92 seems to act as a modulator of apoptosis.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn