TA340301 ICA1L antibody

Rabbit Polyclonal Anti-ICA1L Antibody

See related secondary antibodies

Search for all "ICA1L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish ICA1L

Product Description for ICA1L

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish ICA1L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ICA1L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ALS2CR14, ALS2CR15, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein, Islet cell autoantigen 1-like protein
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NDH6
Immunogen:
The immunogen for anti-ICA1L antibody: synthetic peptide directed towards the middle region of human ICA1L. Synthetic peptide located within the following region: PVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA.
GeneID:
130026
Application WB
Background ICA1L contains 1 AH domain. The function of the ICA1L protein remains.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ICA1L (2 products)

Catalog No. Species Pres. Purity   Source  

ICA1L

ICA1L Human Purified
  Abnova Taiwan Corp.

ICA1L

ICA1L Human Purified
  Abnova Taiwan Corp.

Positive controls for ICA1L (2 products)

Catalog No. Species Pres. Purity   Source  

ALS2CR15 Lysate

Western Blot: ALS2CR15 Lysate [NBL1-11803] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ICA1L.
  Novus Biologicals Inc.

ICA1L 293T Cell Transient Overexpression Lysate(Denatured)

ICA1L 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn