TA340308 CANT1 / SHAPY antibody

Rabbit Polyclonal Anti-CANT1 Antibody

See related secondary antibodies

Search for all "CANT1 / SHAPY"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CANT1 / SHAPY

Product Description for CANT1 / SHAPY

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CANT1 / SHAPY.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CANT1 / SHAPY

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Apyrase homolog, Putative MAPK-activating protein PM09, Putative NF-kappa-B-activating protein 107, SCAN-1, Soluble calcium-activated nucleotidase 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVQ1
Immunogen:
The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY.
GeneID:
124583
Application WB
Background CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP. And it does not hydrolyze AMP and GMP.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CANT1 / SHAPY (6 products)

Catalog No. Species Pres. Purity   Source  

CANT1 / SHAPY (63-401, His-tag)

CANT1 / SHAPY Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

CANT1 / SHAPY (63-401, His-tag)

CANT1 / SHAPY Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

CANT1 / SHAPY

CANT1 / SHAPY Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CANT1 / SHAPY

CANT1 / SHAPY Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CANT1 / SHAPY

CANT1 / SHAPY Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CANT1 / SHAPY

CANT1 / SHAPY Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CANT1 / SHAPY (2 products)

Catalog No. Species Pres. Purity   Source  

CANT1 293T Cell Transient Overexpression Lysate(Denatured)

CANT1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CANT1 Lysate

Western Blot: CANT1 Lysate [NBL1-08672] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CANT1
  Novus Biologicals Inc.
  • LinkedIn