TA340311 ANKRD54 / LIAR antibody

Rabbit Polyclonal Anti-ANKRD54 Antibody

See related secondary antibodies

Search for all "ANKRD54 / LIAR"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ANKRD54 / LIAR

Product Description for ANKRD54 / LIAR

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ANKRD54 / LIAR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ANKRD54 / LIAR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ankyrin repeat domain-containing protein 54
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NXT1
Immunogen:
The immunogen for anti-ANKRD54 antibody: synthetic peptide directed towards the middle region of human ANKRD54. Synthetic peptide located within the following region: EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND.
GeneID:
129138
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ANKRD54 / LIAR (3 products)

Catalog No. Species Pres. Purity   Source  

ANKRD54 / LIAR

ANKRD54 / LIAR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ANKRD54 / LIAR (1-300, His-tag)

ANKRD54 / LIAR Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €820.00
  OriGene Technologies GmbH

ANKRD54 / LIAR (1-300, His-tag)

ANKRD54 / LIAR Human Purified > 85 % by SDS - PAGE E. coli
20 µg / €320.00
  OriGene Technologies GmbH

Positive controls for ANKRD54 / LIAR (2 products)

Catalog No. Species Pres. Purity   Source  

ANKRD54 Lysate

Western Blot: ANKRD54 Lysate [NBL1-07546] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ANKRD54 Protein
  Novus Biologicals Inc.

ANKRD54 overexpression lysate

ANKRD54 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn