TA340318 C7orf31 antibody

Rabbit Polyclonal Anti-C7orf31 Antibody

See related secondary antibodies

Search for all "C7orf31"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat C7orf31

Product Description for C7orf31

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat C7orf31.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C7orf31

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C7orf31
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N865
Immunogen:
The immunogen for anti-C7orf31 antibody: synthetic peptide directed towards the N terminal of human C7orf31. Synthetic peptide located within the following region: EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE.
GeneID:
136895
Application WB
Background The exact function of C7orf31 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C7orf31 (2 products)

Catalog No. Species Pres. Purity   Source  

C7orf31 Lysate

Western Blot: C7orf31 Lysate [NBL1-08552] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C7orf31
  Novus Biologicals Inc.

C7orf31 overexpression lysate

C7orf31 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn