TA340350 WDR66 antibody

Rabbit Polyclonal Anti-WDR66 Antibody

See related secondary antibodies

Search for all "WDR66"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Porcine WDR66

Product Description for WDR66

Rabbit anti Canine, Human, Porcine WDR66.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDR66

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms WD repeat-containing protein 66
Presentation Purified
Reactivity Can, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TBY9
Immunogen:
The immunogen for anti-WDR66 antibody: synthetic peptide directed towards the N terminal of human WDR66. Synthetic peptide located within the following region: GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV.
GeneID:
144406
Application WB
Background WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for WDR66 (2 products)

Catalog No. Species Pres. Purity   Source  

WDR66

WDR66 Human Purified
  Abnova Taiwan Corp.

WDR66

WDR66 Human Purified
  Abnova Taiwan Corp.

Positive controls for WDR66 (2 products)

Catalog No. Species Pres. Purity   Source  

WDR66 293T Cell Transient Overexpression Lysate(Denatured)

WDR66 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

WDR66 overexpression lysate

WDR66 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn