TA340410 NSUN5P1 antibody

Rabbit Polyclonal Anti-NSUN5P1 Antibody

See related secondary antibodies

Search for all "NSUN5P1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat NSUN5P1

Product Description for NSUN5P1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat NSUN5P1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NSUN5P1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NSUN5B, Putative NOL1/NOP2/Sun domain family member 5B, WBSCR20B, Williams-Beuren syndrome chromosomal region 20B protein
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3KNT7
Immunogen:
The immunogen for Anti-NSUN5P1 antibody is: synthetic peptide directed towards the N-terminal region of Human NSUN5P1. Synthetic peptide located within the following region: GTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQEENEDMVPDA.
GeneID:
155400
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn