TA341386 ZBTB10 antibody

Rabbit Polyclonal Anti-ZBTB10 Antibody

See related secondary antibodies

Search for all "ZBTB10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZBTB10

Product Description for ZBTB10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZBTB10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZBTB10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RINZF, RINZFC, Zinc finger and BTB domain-containing protein 10
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96DT7
Immunogen:
The immunogen for anti-ZBTB10 antibody: synthetic peptide directed towards the middle region of human ZBTB10. Synthetic peptide located within the following region: GGQEGVDQGQDTEFPRDEEYEENEVGEADEELVDDGEDQNDPSRWDESGE.
GeneID:
65986
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZBTB10 (2 products)

Catalog No. Species Pres. Purity   Source  

ZBTB10 (transcript variant 2)

ZBTB10 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZBTB10 (transcript variant 1)

ZBTB10 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for ZBTB10 (1 products)

Catalog No. Species Pres. Purity   Source  

ZBTB10 overexpression lysate

ZBTB10 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn