TA341421 RAX2 / QRX antibody

Rabbit Polyclonal Anti-RAX2 Antibody

See related secondary antibodies

Search for all "RAX2 / QRX"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Porcine RAX2 / QRX

Product Description for RAX2 / QRX

Rabbit anti Bovine, Canine, Human, Porcine RAX2 / QRX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAX2 / QRX

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARMD6, CORD11, Q50-type retinal homeobox protein, RAXL1, Retina and anterior neural fold homeobox protein 2, Retina and anterior neural fold homeobox-like protein 1
Presentation Purified
Reactivity Bov, Can, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96IS3
Immunogen:
The immunogen for anti-RAXL1 antibody: synthetic peptide directed towards the N terminal of human RAXL1. Synthetic peptide located within the following region: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASH.
GeneID:
84839
Application WB
Background This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation ofThis gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneathThe retil pigment epithelium and withinThe Bruch's membrane. Defects inThis gene can also cause cone-rod dystrophy type 11, a disease characterized byThe initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed byThe degeneration of rod photoreceptor cells, which progresses to night blindness andThe loss of peripheral vision. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RAX2 / QRX (2 products)

Catalog No. Species Pres. Purity   Source  

RAX2 / QRX

RAX2 / QRX Human Purified
  Abnova Taiwan Corp.

RAX2 / QRX

RAX2 / QRX Human Purified
  Abnova Taiwan Corp.

Positive controls for RAX2 / QRX (2 products)

Catalog No. Species Pres. Purity   Source  

RAX2 Lysate

Western Blot: RAX2 Lysate [NBL1-15183] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RAX2
  Novus Biologicals Inc.

RAX2 overexpression lysate

RAX2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn