TA341426 DMRTB1 antibody

Rabbit Polyclonal Anti-DMRTB1 Antibody

See related secondary antibodies

Search for all "DMRTB1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human DMRTB1

Product Description for DMRTB1

Rabbit anti Bovine, Canine, Equine, Human DMRTB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DMRTB1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Doublesex- and mab-3-related transcription factor B1
Presentation Purified
Reactivity Bov, Can, Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MA1
Immunogen:
The immunogen for anti-DMRTB1 antibody: synthetic peptide directed towards the middle region of human DMRTB1. Synthetic peptide located within the following region: LGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPL.
GeneID:
63948
Application WB
Background Located on chromosome 1,This gene encodes forThe DMRT-like family B with proline-rich C-termil, 1 protein.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DMRTB1 (2 products)

Catalog No. Species Pres. Purity   Source  

DMRTB1

DMRTB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DMRTB1

DMRTB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn