TA341430 ZNF502 antibody

Rabbit Polyclonal Anti-ZNF502 Antibody

See related secondary antibodies

Search for all "ZNF502"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat ZNF502

Product Description for ZNF502

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat ZNF502.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF502

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 502
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TBZ5
Immunogen:
The immunogen for anti-ZNF502 antibody: synthetic peptide directed towards the N terminal of human ZNF502. Synthetic peptide located within the following region: IDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAESCLFQEGGFG.
GeneID:
91392
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF502 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF502

ZNF502 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF502

ZNF502 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF502 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF502 293T Cell Transient Overexpression Lysate(Denatured)

ZNF502 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn